Wealthmaker.in

About Wealthmaker.in

Wealthmaker.in is a financial website that offers a range of services including investment advice, financial planning, and wealth management. The website provides resources and tools for individuals looking to improve their financial situation and make informed decisions about their money. It also offers educational content on various financial topics such as saving, investing, and retirement planning. Wealthmaker.in aims to help users achieve their financial goals through personalized advice and guidance. The website holds a global ranking of 862,170 and is associated with the network IP address 122.180.112.161. It appears that The site is a safe and legit website.

Trace an Email Address

Similar Websites and Competitors to Wealthmaker.in

Top 15 similar sites to Wealthmaker.in. Explore these sites like Wealthmaker and find what you've been searching for!

• wealthmakerfinancialservices.com.au
• wealth-makers.com
• clientfol.io
• cafeconceptsinc.com
• fabasoft.com
• anindia.com
• bajajauto.co.in
• soaring-eagle.org
• bajajcapitalinsurance.com
• justtrade.in
• bajajcapitalone.com
• onebajaj.capital
• dgcmembers.com
• jobzton.com
• anjaliinvestment.com

Wealthmaker.in Global Traffic Rank History

Explore the website's historical data on Global Traffic Rank and track its ranking trends over time.

Wealthmaker.in Server Location

Unveil the Server Location - Explore Where the Website's Servers are Physically Hosted!

India

Wealthmaker.in WHOIS Data

Discover comprehensive domain registration details and more with the accessible Whois data information right here!

Wealthmaker.in DNS Resource Records

Unlock the full potential of the domain with a comprehensive review of its DNS configuration, including SOA, A, AAAA, MX, NS, and TXT records.

@  IN  A  122.180.112.161

@  IN  MX  10 mail.rediffmailpro.com

@  IN  NS  ns.rediffmailpro.com
@  IN  NS  ns2.rediffmailpro.com

@  IN  TXT  "1b26bbmwqybzbwsxx0jw1myqr2nmvbpn"
@  IN  TXT  "2grjw4b53stx9j2ylm340qg2bqr72hlb"
@  IN  TXT  "4vdhsq2jt737chhrkmrh66l6m38z3t7s"
@  IN  TXT  "xs6wh5ympwpq8qjyh14qv5pbzqc6n820"

@  IN SOA  wealthmaker.in. domainadmin.rediff.com
(
        0 ; serial
    28800 ; refresh (8 hours)
     7200 ; retry (2 hours)
  3600000 ; expire (41 days, 16 hours)
    21600 ; minimum (6 hours)
)

Wealthmaker in Frequently Asked Questions (FAQ)

Unveiling the Most Asked Questions - Wealthmaker.in Demystified!

• Is the site safe, legit and trustworthy?

  According to our analysis the site is safe, legit and trustworthy. We haven't found any negative signals.

• Is the site safe for children?

  Currently we have not enough information to determine whether the site is safe for kids or not.

• Who is the registrar for the domain?

  The domain has been registered at Rediff.com India Limited. You can visit the registrar's website at http://www.rediff.co.in.

• What is the IP address?

  The hostname resolves to the IPv4 address 122.180.112.161.

• When did the domain come out?

  The domain was registered 6329 days ago on Wednesday, December 20, 2006.

• When will the domain expire?

  This domain will expire in 975 days on Sunday, December 20, 2026.

• When was the last WHOIS update?

  The WHOIS entry was last updated 872 days ago on Sunday, November 28, 2021.

• What are the domain's nameservers?

  DNS is provided by the nameservers ns.rediffmailpro.com and ns2.rediffmailpro.com.

• What is the domain's traffic rank?

  The site ranks 862,170 globally.

• How many people visit the site each day?

  The site receives approximately 8.1 Thousand visitors and 56 Thousand page impressions per day.

• Where are the server locations?

  The site has its servers located in India.

• What webserver software is used?

  The website is powered by "Microsoft-IIS/7.5" webserver.

See also